{"product_id":"heywell-energy-lift-orange-mango","title":"Heywell Energy + Lift Orange Mango","description":"\u003cp\u003e\u003cmeta charset=\"utf-8\"\u003e\u003cspan\u003eMade to help brighten your mood and give you energy. Sparkling orange mango tastes like sunshine in a can. Only 25 calories and 2 grams of sugar, it's made with a mix of adaptogens, antioxidants and organic caffeine. It’ll be your new favorite energy drink with a boost of good vibes! Skip the stress and support mood with Ashwagandha and Ginseng adaptogens that help with fatigue and occasional stress. Stay strong with Schisandra and Amla Berry antioxidant super berries that help de-stress and support immunity Calm nerves with Lemon Balm and L-theanine an herb from the mint family and an amino acid found in green tea, they help calm frazzled nerves 75mg organic caffeine from organic green coffee beans - like a small cup of coffee.\u003c\/span\u003e\u003c\/p\u003e","brand":"Airgoods","offers":[{"title":"Default Title","offer_id":53099449975057,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0739\/6409\/3713\/files\/heywell-heywellenergyliftsparklingorangemango12pkcans-001-8d3d73f1-0d4b-4fe9-943f-4034de199c13.webp?v=1770235306","url":"https:\/\/killjoyshop.com\/products\/heywell-energy-lift-orange-mango","provider":"Killjoy","version":"1.0","type":"link"}